PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000558493
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family NAC
Protein Properties Length: 396aa    MW: 44684.4 Da    PI: 7.9699
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000558493genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1713.7e-5391381129
            NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvka.eekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 
                    +ppGfrFhPtdeel+++yLkkkv+ +k+++ evi+evd++k+ePw+L++  ++ +  ++ewyfFs++d+ky+tg+r+nrat++g+Wkatg+dk + 
  MDP0000558493   9 VPPGFRFHPTDEELLHYYLKKKVSFQKFDM-EVIREVDLNKMEPWELQErcRIGStPQNEWYFFSHKDRKYPTGSRTNRATNAGFWKATGRDKCIR 103
                    69****************************.99**************963433332556************************************* PP

            NAM  94 skkgelvglkktLvfykgrapkgektdWvmheyrle 129
                    + + +++g++ktLvfy+grap+g+ktdW+mheyrle
  MDP0000558493 104 N-TFKKIGMRKTLVFYRGRAPHGQKTDWIMHEYRLE 138
                    9.8899****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.18E-598161IPR003441NAC domain
PROSITE profilePS5100557.739161IPR003441NAC domain
PfamPF023658.3E-2810137IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009834Biological Processplant-type secondary cell wall biogenesis
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048829Biological Processroot cap development
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 396 aa     Download sequence    Send to blast
MANSSTGGVP PGFRFHPTDE ELLHYYLKKK VSFQKFDMEV IREVDLNKME PWELQERCRI  60
GSTPQNEWYF FSHKDRKYPT GSRTNRATNA GFWKATGRDK CIRNTFKKIG MRKTLVFYRG  120
RAPHGQKTDW IMHEYRLEDG DDPQGNLSSE DGWVICRVFK KKNLFKVANE GGSSSMNSSE  180
HQQLNNASSN SQLQARSFMH SHRDNQYLLR QQHHAATQGF QLNNNSSLHY AHLQSPPHYS  240
VFQSQALIPT LAHKPLSSYD DYSSQLPSDD SPAHGMVKQL MTNPRDCKSG SEGLRYQACE  300
PGLEVGTCEP DHQPNMVGGG AGTAGGRDNN HDHQGMSEWA MLDRLVTSHD LGNDQDSSSK  360
GTARYGDANA PSSVNQINHQ HLSLRGEMDF WGYAK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-51916317167NO APICAL MERISTEM PROTEIN
1ut4_B1e-51916317167NO APICAL MERISTEM PROTEIN
1ut7_A1e-51916317167NO APICAL MERISTEM PROTEIN
1ut7_B1e-51916317167NO APICAL MERISTEM PROTEIN
3swm_A2e-51916320170NAC domain-containing protein 19
3swm_B2e-51916320170NAC domain-containing protein 19
3swm_C2e-51916320170NAC domain-containing protein 19
3swm_D2e-51916320170NAC domain-containing protein 19
3swp_A2e-51916320170NAC domain-containing protein 19
3swp_B2e-51916320170NAC domain-containing protein 19
3swp_C2e-51916320170NAC domain-containing protein 19
3swp_D2e-51916320170NAC domain-containing protein 19
4dul_A1e-51916317167NAC domain-containing protein 19
4dul_B1e-51916317167NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00431DAPTransfer from AT4G10350Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2103824e-43AC210382.1 Populus trichocarpa clone POP018-P22, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008391860.10.0PREDICTED: protein BEARSKIN1
SwissprotQ9SV871e-154BRN2_ARATH; Protein BEARSKIN2
TrEMBLM5VLK30.0M5VLK3_PRUPE; Uncharacterized protein
STRINGPOPTR_0019s09400.11e-177(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF87523343
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G10350.11e-149NAC domain containing protein 70